Skip to product information
1 of 1

IP-10/CXCL10, Rhesus macaque (His)

IP-10/CXCL10, Rhesus macaque (His)

Size

SKU:QM-0203051-01

£90.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CXCL10 protein acts as a chemotactic factor for monocytes and T-lymphocytes, playing a crucial role in their migration in response to inflammatory signals. Through binding to CXCR3, CXCL10 selectively attracts monocytes and T-lymphocytes, positioning it as a key player in immune responses, contributing to the recruitment and activation of these immune cells in various physiological and pathological contexts. IP-10/CXCL10 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL10 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    574243 (Gene_ID) Q8MIZ1 (I22-P98) (Accession)

  • Smiles

    IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

  • Purity

    97.4

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203051-01
2 µgQM-0203051-01
£90.25/ea
£0.00
£90.25/ea £0.00
10 µgQM-0203051-02
10 µgQM-0203051-02
£248.04/ea
£0.00
£248.04/ea £0.00
50 µgQM-0203051-03
50 µgQM-0203051-03
£604.04/ea
£0.00
£604.04/ea £0.00
100 µgQM-0203051-04
100 µgQM-0203051-04
£990.41/ea
£0.00
£990.41/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IP-10/CXCL10, Rhesus macaque (His)

IP-10/CXCL10, Rhesus macaque (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.