Name: Irisin, Human/Mouse/Rat (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0205968-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
Irisin Protein is an important cytokine secreted by muscles during exercise, which has multiple functions such as regulating metabolism and improving health. Irisin Protein, Human/Mouse/Rat (HEK293, Fc) is a recombinant Irisin Protein expressed by HEK293 and carrying a C-hFc tag[1][2][3].
Molecular Formula
252995 (Gene_ID) Q8NAU1-1 (D32-E143) (Accession)
Smiles
DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205968-01	2 µgQM-0205968-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0205968-02	10 µgQM-0205968-02 £104.88/ea	£0.00	Quantity	£104.88/ea	£0.00

50 µgQM-0205968-03	50 µgQM-0205968-03 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

100 µgQM-0205968-04	100 µgQM-0205968-04 £465.53/ea	£0.00	Quantity	£465.53/ea	£0.00

250 µgQM-0205968-05	250 µgQM-0205968-05 £879.85/ea	£0.00	Quantity	£879.85/ea	£0.00

500 µgQM-0205968-06	500 µgQM-0205968-06 £1,377.99/ea	£0.00	Quantity	£1,377.99/ea	£0.00

1 mgQM-0205968-07	1 mgQM-0205968-07 £1,932.04/ea	£0.00	Quantity	£1,932.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Irisin, Human/Mouse/Rat (HEK293, Fc)

Irisin, Human/Mouse/Rat (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.