Skip to product information
1 of 1

ITGBL1, Human (Myc, His)

ITGBL1, Human (Myc, His)

Size

SKU:QM-0204222-01

£222.53 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family, containing integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 Protein, Human (Myc, His) is the recombinant human-derived ITGBL1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

  • Molecular Formula

    9358 (Gene_ID) O95965 (V24-P494) (Accession)

  • Smiles

    VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204222-01
5 µgQM-0204222-01
£222.53/ea
£0.00
£222.53/ea £0.00
10 µgQM-0204222-02
10 µgQM-0204222-02
£342.81/ea
£0.00
£342.81/ea £0.00
20 µgQM-0204222-03
20 µgQM-0204222-03
£548.15/ea
£0.00
£548.15/ea £0.00
50 µgQM-0204222-04
50 µgQM-0204222-04
£929.66/ea
£0.00
£929.66/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ITGBL1, Human (Myc, His)

ITGBL1, Human (Myc, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.