JAM-C/CD323, Human (HEK293)

Name: JAM-C/CD323, Human (HEK293)
Brand: QuantiMol
SKU: QM-0202689-01
Price: 62.26 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202689-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The JAM-C/CD323 protein is a junctional adhesion protein that regulates various cellular processes by interacting with JAM2 and JAM3. It is essential for the homing of hematopoietic cells in the bone marrow, promotes leukocyte migration, and participates in spermatogenesis by anchoring germ cells. JAM-C/CD323 Protein, Human (HEK293) is the recombinant human-derived JAM-C/CD323 protein, expressed by HEK293 , with tag free.
Molecular Formula
83700 (Gene_ID) Q9BX67 (V32-N241) (Accession)
Smiles
VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202689-01	5 µgQM-0202689-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0202689-02	10 µgQM-0202689-02 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

50 µgQM-0202689-03	50 µgQM-0202689-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

100 µgQM-0202689-04	100 µgQM-0202689-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

JAM-C/CD323, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.