JAM-C/CD323, Mouse (HEK293, His)

Name: JAM-C/CD323, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0203500-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203500-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
JAM-C/CD323 protein and JAM2 participate in a variety of cell-cell interactions and regulate cellular processes. It plays a key role in the homing and retention of hematopoietic cells in the bone marrow. JAM-C/CD323 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-C/CD323 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
83964 (Gene_ID) Q9D8B7/NP_075766.1 (E30-N241) (Accession)
Smiles
EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLN
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203500-01	5 µgQM-0203500-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0203500-02	10 µgQM-0203500-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0203500-03	50 µgQM-0203500-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0203500-04	100 µgQM-0203500-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

JAM-C/CD323, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.