Skip to product information
1 of 1

JOSD2, Human

JOSD2, Human

Size

SKU:QM-0105176-01

£341.08 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The JOSD2 protein serves as an enzymatic entity capable of cleaving "Lys-63"-linked polyubiquitin chains and, to a lesser extent, "Lys-48"-linked polyubiquitin chains in vitro. This suggests its potential role as a deubiquitinating enzyme involved in the removal of specific ubiquitin linkages. JOSD2 Protein, Human is the recombinant human-derived JOSD2 protein, expressed by E. coli , with tag free.

  • Molecular Formula

    126119 (Gene_ID) Q8TAC2-1 (S2-D188) (Accession)

  • Smiles

    SQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0105176-01
10 µgQM-0105176-01
£341.08/ea
£0.00
£341.08/ea £0.00
50 µgQM-0105176-02
50 µgQM-0105176-02
£827.09/ea
£0.00
£827.09/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

JOSD2, Human

JOSD2, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.