1 1

Kallikrein-1, Human (244a.a, HEK293, His, solution)

Kallikrein-1, Human (244a.a, HEK293, His, solution)

Size

QM-0189808-01

£239.03 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Kallikrein-1 protein cleaves bonds in kininogen to release Lys-bradykinin. It also cleaves Neisseria meningitidis NHBA in saliva during microbial infection.Kallikrein-1 Protein, Human (244a.a, HEK293, His, solution) is the recombinant human-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    3816 (Gene_ID) AAH05313.1 (P19-S262) (Accession)

  • Smiles

    PPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.
Learn more
Variant Variant total Quantity Price Variant total
10 µgQM-0189808-01
10 µgQM-0189808-01
£239.03/ea		 £0.00
£239.03/ea £0.00
50 µgQM-0189808-02
50 µgQM-0189808-02
£531.84/ea		 £0.00
£531.84/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Kallikrein-1, Human (244a.a, HEK293, His, solution)

Kallikrein-1, Human (244a.a, HEK293, His, solution) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.