Kallikrein-10, Human (HEK293, His)
Kallikrein-10, Human (HEK293, His)
SKU:QM-0111378
Request quote or documents

Product Details
-
Description
Kallikrein-10 protein has a tumor suppressive effect, especially in breast and prostate cancer, by inhibiting NES1. This emphasizes its importance in mitigating tumorigenesis in these specific types of cancer. Kallikrein-10 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-10 protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
5655 (Gene_ID) O43240 (A31-N276) (Accession)
-
Smiles
AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
Kallikrein-10, Human (HEK293, His)
Kallikrein-10, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.