Skip to product information
1 of 1

Kallikrein-10, Human (HEK293, His)

Kallikrein-10, Human (HEK293, His)

Size

SKU:QM-0111378

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Kallikrein-10 protein has a tumor suppressive effect, especially in breast and prostate cancer, by inhibiting NES1. This emphasizes its importance in mitigating tumorigenesis in these specific types of cancer. Kallikrein-10 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-10 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    5655 (Gene_ID) O43240 (A31-N276) (Accession)

  • Smiles

    AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0111378
1 EachQM-0111378
£0.00/ea
£0.00
£0.00/ea £0.00

Kallikrein-10, Human (HEK293, His)

Kallikrein-10, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.