1 1

Kallikrein-3/PSA, Human (244a.a, HEK293, His)

Kallikrein-3/PSA, Human (244a.a, HEK293, His)

Size

QM-0204077-01

£91.38 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    354 (Gene_ID) P07288 (A18-P261) (Accession)

  • Smiles

    APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0204077-01
5 µgQM-0204077-01
£91.38/ea		 £0.00
£91.38/ea £0.00
10 µgQM-0204077-02
10 µgQM-0204077-02
£127.38/ea		 £0.00
£127.38/ea £0.00
50 µgQM-0204077-03
50 µgQM-0204077-03
£359.82/ea		 £0.00
£359.82/ea £0.00
100 µgQM-0204077-04
100 µgQM-0204077-04
£548.15/ea		 £0.00
£548.15/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Kallikrein-3/PSA, Human (244a.a, HEK293, His)

Kallikrein-3/PSA, Human (244a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.