Skip to product information
1 of 1

Kallikrein-5, Mouse (HEK293, His)

Kallikrein-5, Mouse (HEK293, His)

Size

SKU:QM-0200127-01

£216.46 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The Kallikrein-5 protein may be involved in desquamation, suggesting a role in the process of skin shedding and exfoliation. Its association with desquamation suggests that it plays a role in regulating the removal of dead skin cells, which is critical for skin homeostasis. Kallikrein-5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-5 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    68668 (Gene_ID) Q9D140 (G30-N293) (Accession)

  • Smiles

    GDVSSCDNPSGTEPSGTNRDLSTDSKSGEDTRSDSSSRIVNGSDCQKDAQPWQGALLLGPNKLYCGAVLISPQWLLTAAHCRKPVFRIRLGHHSMSPVYESGQQMFQGIKSIPHPGYSHPGHSNDLMLIKMNRKIRDSHSVKPVEIACDCATEGTRCMVSGWGTTSSSHNNFPKVLQCLNITVLSEERCKNSYPGQIDKTMFCAGDEEGRDSCQGDSGGPVVCNGKLQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIKDTMNSN

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0200127-01
20 µgQM-0200127-01
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0200127-02
50 µgQM-0200127-02
£365.90/ea
£0.00
£365.90/ea £0.00
100 µgQM-0200127-03
100 µgQM-0200127-03
£559.09/ea
£0.00
£559.09/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Kallikrein-5, Mouse (HEK293, His)

Kallikrein-5, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.