Kallikrein-8, Mouse (P.pastoris, His)

Name: Kallikrein-8, Mouse (P.pastoris, His)
Brand: QuantiMol
SKU: QM-0194798-01
Price: 210.38 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0194798-01

£210.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Kallikrein-8 is a serine protease that degrades proteins such as casein and fibrinogen. It cleaves L1CAM, inducing neurite outgrowth and fasciculations. Kallikrein-8 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Kallikrein-8 protein, expressed by P. pastoris , with N-6*His labeled tag.
Molecular Formula
259277 (Gene_ID) Q61955 (I33-D260) (Accession)
Smiles
ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0194798-01	5 µgQM-0194798-01 £210.38/ea	£0.00	Quantity	£210.38/ea	£0.00

10 µgQM-0194798-02	10 µgQM-0194798-02 £320.94/ea	£0.00	Quantity	£320.94/ea	£0.00

50 µgQM-0194798-03	50 µgQM-0194798-03 £625.91/ea	£0.00	Quantity	£625.91/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Kallikrein-8, Mouse (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.