Skip to product information
1 of 1

KGF/FGF-7, Human

KGF/FGF-7, Human

Size

SKU:QM-0206000-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    KGF/FGF-7 Protein is an epithelial cell-specific mitogen secreted by normal stromal fibroblasts. KGF/FGF-7 Protein activates plasminogen activator (PA) activity to promote extracellular matrix degradation. KGF/FGF-7 Protein, Human has activities such as promoting the proliferation and differentiation of epithelial cells (such as keratinocytes, thymic epithelial cells), repairing tissue damage (such as intestinal ischemia/reperfusion injury, bone defects), and regulating immune function (such as improving thymus function in aged mice) . KGF/FGF-7 Protein, Human is a recombinant KGF/FGF-7 protein expressed by E. coli without a tag.

  • Molecular Formula

    2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

  • Smiles

    CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0206000-01
2 µgQM-0206000-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0206000-02
10 µgQM-0206000-02
£205.52/ea
£0.00
£205.52/ea £0.00
50 µgQM-0206000-03
50 µgQM-0206000-03
£492.26/ea
£0.00
£492.26/ea £0.00
100 µgQM-0206000-04
100 µgQM-0206000-04
£758.35/ea
£0.00
£758.35/ea £0.00
250 µgQM-0206000-05
250 µgQM-0206000-05
£1,113.13/ea
£0.00
£1,113.13/ea £0.00
500 µgQM-0206000-06
500 µgQM-0206000-06
£1,433.88/ea
£0.00
£1,433.88/ea £0.00
1 mgQM-0206000-07
1 mgQM-0206000-07
£2,042.60/ea
£0.00
£2,042.60/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

KGF/FGF-7, Human

KGF/FGF-7, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.