Name: KGF/FGF-7, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0205994-01
Price: 72.61 GBP
Availability: InStock

Product Details

Description
KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7 Protein, Human (HEK293, His) is the recombinant human-derived KGF/FGF-7 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
2252 (Gene_ID) P21781-1 (C32-T194) (Accession)
Smiles
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Purity
97.17
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205994-01	2 µgQM-0205994-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0205994-02	10 µgQM-0205994-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0205994-03	50 µgQM-0205994-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0205994-04	100 µgQM-0205994-04 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

250 µgQM-0205994-05	250 µgQM-0205994-05 £1,156.87/ea	£0.00	Quantity	£1,156.87/ea	£0.00

500 µgQM-0205994-06	500 µgQM-0205994-06 £1,544.45/ea	£0.00	Quantity	£1,544.45/ea	£0.00

1 mgQM-0205994-07	1 mgQM-0205994-07 £2,153.16/ea	£0.00	Quantity	£2,153.16/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

KGF/FGF-7, Human (HEK293, His)

KGF/FGF-7, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.