KGF/FGF-7, Human (N-His)

Name: KGF/FGF-7, Human (N-His)
Brand: QuantiMol
SKU: QM-0202930-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202930-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
KGF/FGF-7 Protein, Human (His) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein, Human (His) and its receptor are important for normal wound healing.
Molecular Formula
2252 (Gene_ID) P21781-1 (C32-T194) (Accession)
Smiles
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202930-01	2 µgQM-0202930-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0202930-02	10 µgQM-0202930-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0202930-03	50 µgQM-0202930-03 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

100 µgQM-0202930-04	100 µgQM-0202930-04 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

KGF/FGF-7, Human (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.