Skip to product information
1 of 1

KIAA0101, Human (His)

KIAA0101, Human (His)

Size

SKU:QM-0202486-01

£97.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH) . KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    9768 (Gene_ID) Q15004-1 (M1-E111) (Accession)

  • Smiles

    MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202486-01
5 µgQM-0202486-01
£97.00/ea
£0.00
£97.00/ea £0.00
10 µgQM-0202486-02
10 µgQM-0202486-02
£137.50/ea
£0.00
£137.50/ea £0.00
50 µgQM-0202486-03
50 µgQM-0202486-03
£370.76/ea
£0.00
£370.76/ea £0.00
100 µgQM-0202486-04
100 µgQM-0202486-04
£565.16/ea
£0.00
£565.16/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

KIAA0101, Human (His)

KIAA0101, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.