Skip to product information
1 of 1

KIR3DL3/CD158z, Human (HEK293, His)

KIR3DL3/CD158z, Human (HEK293, His)

Size

SKU:QM-0202651-01

£68.47 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    115653 (Gene_ID) Q8N743/NP_703144.2 (Q26-L322) (Accession)

  • Smiles

    QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202651-01
5 µgQM-0202651-01
£68.47/ea
£0.00
£68.47/ea £0.00
10 µgQM-0202651-02
10 µgQM-0202651-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0202651-03
50 µgQM-0202651-03
£288.14/ea
£0.00
£288.14/ea £0.00
100 µgQM-0202651-04
100 µgQM-0202651-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

KIR3DL3/CD158z, Human (HEK293, His)

KIR3DL3/CD158z, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.