KIR3DS1/CD158e2, Human (CHO, His)

Name: KIR3DS1/CD158e2, Human (CHO, His)
Brand: QuantiMol
SKU: QM-0203339-01
Price: 94.75 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203339-01

£94.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
KIR3DS1/CD158e2, located on NK cells, serves as a receptor for MHC class I molecules. Its crucial role includes triggering NK cell degranulation and inducing the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. This direct engagement highlights KIR3DS1/CD158e2 as a key modulator of NK cell responses, particularly in anti-viral immune reactions. KIR3DS1/CD158e2 Protein, Human (CHO, His) is the recombinant human-derived KIR3DS1/CD158e2 protein, expressed by CHO , with tag free.
Molecular Formula
3813 (Gene_ID) Q14943-1 (H22-H340) (Accession)
Smiles
HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH
Purity
91
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203339-01	5 µgQM-0203339-01 £94.75/ea	£0.00	Quantity	£94.75/ea	£0.00

10 µgQM-0203339-02	10 µgQM-0203339-02 £135.25/ea	£0.00	Quantity	£135.25/ea	£0.00

50 µgQM-0203339-03	50 µgQM-0203339-03 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

100 µgQM-0203339-04	100 µgQM-0203339-04 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

KIR3DS1/CD158e2, Human (CHO, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.