Klrb1a, Mouse (HEK293, His)

Name: Klrb1a, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0203392-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 5 µg 50 µg 100 µg

SKU:QM-0203392-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.
Molecular Formula
17057 (Gene_ID) P27811 (Q67-H227) (Accession)
Smiles
QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203392-01	2 µgQM-0203392-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

5 µgQM-0203392-02	5 µgQM-0203392-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0203392-03	50 µgQM-0203392-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0203392-04	100 µgQM-0203392-04 £426.65/ea	£0.00	Quantity	£426.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Klrb1a, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.