KLRB1F/CD161f, Mouse (HEK293, Fc)

Name: KLRB1F/CD161f, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0195971-01
Price: 91.38 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0195971-01

£91.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The KLRB1F/CD161f protein is thought to bind CLEC2I/Clr-g, activate natural killer cells and provide costimulation for IL-2 production and T cell proliferation. This dual function highlights its critical role in coordinating immune responses. KLRB1F/CD161f Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived KLRB1F/CD161f protein, expressed by HEK293 , with N-hFc labeled tag.
Molecular Formula
232408 (Gene_ID) Q8VD98 (Q67-V217) (Accession)
Smiles
QKPPIEKCSVAAQENRTELTGRSAILECPRYWHPHWNKCLFVSQISRPWAEGRDACSMEDAILLLIENKEELRFVQNLIKGKEQLFFIGLKYVQKEKIWKWIDGSILNPNLLRITGKDKENSCAIISHTEVFSDSCSSDNHWICQKTLIHV
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0195971-01	5 µgQM-0195971-01 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

10 µgQM-0195971-02	10 µgQM-0195971-02 £133.00/ea	£0.00	Quantity	£133.00/ea	£0.00

50 µgQM-0195971-03	50 µgQM-0195971-03 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

KLRB1F/CD161f, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.