Skip to product information
1 of 1

Kras4B Protein, Human (G12V, His)

Kras4B Protein, Human (G12V, His)

Size

SKU:QM-0170323-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The Kras4B protein interacts specifically with GPR31, dependent on farnesylation. This binding suggests a regulatory role for Kras4B in association with GPR31, emphasizing the importance of the farnesylation process. Comprehensive exploration into the molecular details of this interaction is crucial to understand the precise mechanisms and functional implications in cellular processes or signaling pathways. Kras4B Protein, Human (G12V, His) is the recombinant human-derived Kras4B protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    3845 (Gene_ID) P01116-2 (M1-K169, G12V) (Accession)

  • Smiles

    MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0170323-01
10 µgQM-0170323-01
£72.61/ea
£0.00
£72.61/ea £0.00
50 µgQM-0170323-02
50 µgQM-0170323-02
£216.46/ea
£0.00
£216.46/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Kras4B Protein, Human (G12V, His)

Kras4B Protein, Human (G12V, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.