KREMEN1, Human (HEK293, His)

Name: KREMEN1, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0202712-01
Price: 68.47 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202712-01

£68.47 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
KREMEN1 Protein, Human (HEK293, His) is the recombinant human-derived KREMEN1 protein, expressed by HEK293, with C-His labeled tag.
Molecular Formula
83999 (Gene_ID) Q96MU8-2/NP_114434.3 (A20-T394) (Accession)
Smiles
ARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEGWT
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202712-01	5 µgQM-0202712-01 £68.47/ea	£0.00	Quantity	£68.47/ea	£0.00

10 µgQM-0202712-02	10 µgQM-0202712-02 £104.88/ea	£0.00	Quantity	£104.88/ea	£0.00

50 µgQM-0202712-03	50 µgQM-0202712-03 £293.00/ea	£0.00	Quantity	£293.00/ea	£0.00

100 µgQM-0202712-04	100 µgQM-0202712-04 £459.45/ea	£0.00	Quantity	£459.45/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

KREMEN1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.