Skip to product information
1 of 1

KYAT1, Human (His)

KYAT1, Human (His)

Size

SKU:QM-0169616-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The KYAT1 protein catalyzes the irreversible ammonia action of L-kynurenine to produce kynurenic acid (KA), which is an intermediate in the tryptophan catabolic pathway and a broad-spectrum antagonist of excitatory amino acid receptors. KYAT1 Protein, Human (His) is the recombinant human-derived KYAT1 protein, expressed by E. coli , with C-6*His labeled tag.

  • Molecular Formula

    883 (Gene_ID) Q16773-2 (M1-L372) (Accession)

  • Smiles

    MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0169616-01
2 µgQM-0169616-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0169616-02
10 µgQM-0169616-02
£115.00/ea
£0.00
£115.00/ea £0.00
50 µgQM-0169616-03
50 µgQM-0169616-03
£293.00/ea
£0.00
£293.00/ea £0.00
100 µgQM-0169616-04
100 µgQM-0169616-04
£437.58/ea
£0.00
£437.58/ea £0.00
500 µgQM-0169616-05
500 µgQM-0169616-05
£1,245.56/ea
£0.00
£1,245.56/ea £0.00
1 mgQM-0169616-06
1 mgQM-0169616-06
£1,798.38/ea
£0.00
£1,798.38/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

KYAT1, Human (His)

KYAT1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.