Skip to product information
1 of 1

LAG-3, Human (HEK293, Fc)

LAG-3, Human (HEK293, Fc)

Size

SKU:QM-0185731-01

£142.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8 (+) and CD4 (+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (HEK293, Fc) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    3902 (Gene_ID) P18627-1 (L23-L450) (Accession)

  • Smiles

    LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0185731-01
10 µgQM-0185731-01
£142.25/ea
£0.00
£142.25/ea £0.00
50 µgQM-0185731-02
50 µgQM-0185731-02
£352.02/ea
£0.00
£352.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

LAG-3, Human (HEK293, Fc)

LAG-3, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.