Skip to product information
1 of 1

LAMP3/CD208, Rhesus Macaque (HEK293, His)

LAMP3/CD208, Rhesus Macaque (HEK293, His)

Size

SKU:QM-0203401-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The LAMP3/CD208 protein is a lysosomal membrane glycoprotein that actively participates in the unfolded protein response (UPR), aiding protein degradation and cell survival during proteasome dysfunction. It is essential for lysosome-autophagosome fusion, where it regulates the autophagy process. LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    574213 (Gene_ID) Q8MJJ2 (K28-T381) (Accession)

  • Smiles

    KAFPKTRDYSQPTAAATGQDIAKPVQQPANQAPHQTLAARLMDGHITFQTAATIKTPTTTPVTTKNTPTTSPIIYTLVTTQATSNNSHTAPPLTKVTVGPSLAPYSLPPTITPPAHTTGTSSSTVNHTTGNATQPSNQTTLPATLSIAPHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGSTLAPQPSSIKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNLDPNATQASGNCGTRNSNLLLNFQGGFVNLTFTKDEGSYYISEVGACLTVSDPETIYQGMKHAVVMFQTVVGHSFKCVSEQSLQLSAHLQLKTTNVQLQAFDFEDDHFGNVDECSSDYT

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0203401-01
5 µgQM-0203401-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0203401-02
10 µgQM-0203401-02
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0203401-03
50 µgQM-0203401-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0203401-04
100 µgQM-0203401-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

LAMP3/CD208, Rhesus Macaque (HEK293, His)

LAMP3/CD208, Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.