Layilin/LAYN, Rhesus Macaque (HEK293, His)

Name: Layilin/LAYN, Rhesus Macaque (HEK293, His)
Brand: QuantiMol
SKU: QM-0203247-01
Price: 72.61 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203247-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Layilin/LAYN Protein serves as a receptor for hyaluronate and interacts with NF2, RDX, and TLN1. Layilin/LAYN Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Layilin/LAYN protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
710211 (Gene_ID) F6ZPB5/XP_001105766.1 (A22-E220) (Accession)
Smiles
ATGRLLSGQPVCRGGTQRPCYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQNLIEKFIENLLPSDGDFWIGLRRREEKQSNSTACEDLYAWTDGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKNNFICKYSDEKPAVPSREPEGEETEPTTPVLLEETQEEDAKKTFKESRE
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203247-01	5 µgQM-0203247-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0203247-02	10 µgQM-0203247-02 £111.63/ea	£0.00	Quantity	£111.63/ea	£0.00

50 µgQM-0203247-03	50 µgQM-0203247-03 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0203247-04	100 µgQM-0203247-04 £504.41/ea	£0.00	Quantity	£504.41/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Layilin/LAYN, Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.