Skip to product information
1 of 1

LDLR, Human (HEK293, His)

LDLR, Human (HEK293, His)

Size

SKU:QM-0204251-01

£89.13 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293, His) is the recombinant human-derived LDLR protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    3949 (Gene_ID) P01130-1 (A22-R788) (Accession)

  • Smiles

    AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204251-01
5 µgQM-0204251-01
£89.13/ea
£0.00
£89.13/ea £0.00
10 µgQM-0204251-02
10 µgQM-0204251-02
£134.13/ea
£0.00
£134.13/ea £0.00
50 µgQM-0204251-03
50 µgQM-0204251-03
£327.02/ea
£0.00
£327.02/ea £0.00
100 µgQM-0204251-04
100 µgQM-0204251-04
£492.26/ea
£0.00
£492.26/ea £0.00
250 µgQM-0204251-05
250 µgQM-0204251-05
£935.74/ea
£0.00
£935.74/ea £0.00
500 µgQM-0204251-06
500 µgQM-0204251-06
£1,488.56/ea
£0.00
£1,488.56/ea £0.00
1 mgQM-0204251-07
1 mgQM-0204251-07
£2,207.84/ea
£0.00
£2,207.84/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

LDLR, Human (HEK293, His)

LDLR, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.