Skip to product information
1 of 1

Leptin, Human (His)

Leptin, Human (His)

Size

SKU:QM-0199067-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Leptin is a cytokine-like sugar secretory protein secreted by adipocytes that helps regulate energy balance by inhibiting food intake and increasing thermogenesis. Leptin can activate the JAK2-STAT3 and PI3K-AKT/mTOR pathways to regulate energy metabolism, prolong the QT interval via MAPK in the myocardium, and play a protective role in the gastric mucosa by inducing NO/CGRP release via the vagus nerve. Circulating CRP protein binds to leptin and blocks signal transduction, leading to obesity resistance. Leptin Protein, Human (His) is a recombinant human Leptin protein expressed by E. coli with N-6*His tag.

  • Molecular Formula

    3952 (Gene_ID) P41159 (V22-C167) (Accession)

  • Smiles

    VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0199067-01
2 µgQM-0199067-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0199067-02
10 µgQM-0199067-02
£75.72/ea
£0.00
£75.72/ea £0.00
50 µgQM-0199067-03
50 µgQM-0199067-03
£122.88/ea
£0.00
£122.88/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Leptin, Human (His)

Leptin, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.