1 1

Leptin, Rat

Leptin, Rat

Size

QM-0205283-01

£52.94 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Leptin Protein, Rat is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

  • Molecular Formula

    25608 (Gene_ID) P50596 (V22-C167) (Accession)

  • Smiles

    VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0205283-01
2 µgQM-0205283-01
£52.94/ea		 £0.00
£52.94/ea £0.00
10 µgQM-0205283-02
10 µgQM-0205283-02
£64.33/ea		 £0.00
£64.33/ea £0.00
50 µgQM-0205283-03
50 µgQM-0205283-03
£79.85/ea		 £0.00
£79.85/ea £0.00
100 µgQM-0205283-04
100 µgQM-0205283-04
£109.38/ea		 £0.00
£109.38/ea £0.00
200 µgQM-0205283-05
200 µgQM-0205283-05
£143.13/ea		 £0.00
£143.13/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Leptin, Rat

Leptin, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.