Leptin, Rat (His)

Name: Leptin, Rat (His)
Brand: QuantiMol
SKU: QM-0169691-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 200 µg

SKU:QM-0169691-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Leptin Protein, Rat is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.
Molecular Formula
25608 (Gene_ID) P50596 (V22-C167) (Accession)
Smiles
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0169691-01	2 µgQM-0169691-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0169691-02	10 µgQM-0169691-02 £67.44/ea	£0.00	Quantity	£67.44/ea	£0.00

50 µgQM-0169691-03	50 µgQM-0169691-03 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

100 µgQM-0169691-04	100 µgQM-0169691-04 £133.00/ea	£0.00	Quantity	£133.00/ea	£0.00

200 µgQM-0169691-05	200 µgQM-0169691-05 £224.96/ea	£0.00	Quantity	£224.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Leptin, Rat (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.