Skip to product information
1 of 1

Leukocidin-F subunit/LukF, S. aureus (Myc, His-SUMO)

Leukocidin-F subunit/LukF, S. aureus (Myc, His-SUMO)

Size

SKU:QM-0180651-01

£232.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Leukocidin-F subunit/LukF protein induces cytotoxic changes in polymorphonuclear leukocytes, while gamma-hemolysin, with components H-gamma-I and H-gamma-II identical to F, causes hemolysis in red blood cells. These proteins collectively contribute to pathogenic mechanisms by exerting cytotoxic effects on immune cells and inducing hemolysis in red blood cells. Leukocidin-F subunit/LukF Protein, S. aureus (Myc, His-SUMO) is the recombinant Staphylococcus aureus-derived Leukocidin-F subunit/LukF protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

  • Molecular Formula

    / (Gene_ID) P31715 (A26-K323) (Accession)

  • Smiles

    AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0180651-01
20 µgQM-0180651-01
£232.25/ea
£0.00
£232.25/ea £0.00
50 µgQM-0180651-02
50 µgQM-0180651-02
£404.78/ea
£0.00
£404.78/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Leukocidin-F subunit/LukF, S. aureus (Myc, His-SUMO)

Leukocidin-F subunit/LukF, S. aureus (Myc, His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.