Skip to product information
1 of 1

LHPP, Human (His-SUMO)

LHPP, Human (His-SUMO)

Size

SKU:QM-0197709-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    LHPP Protein, a phosphatase, exhibits broad substrate specificity, efficiently hydrolyzing imidodiphosphate, 3-phosphohistidine, and 6-phospholysine. It can also hydrolyze inorganic diphosphate, albeit less efficiently. LHPP Protein, Human (His-SUMO) is the recombinant human-derived LHPP protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Molecular Formula

    64077 (Gene_ID) Q9H008-1 (M1-K270) (Accession)

  • Smiles

    MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0197709-01
5 µgQM-0197709-01
£101.50/ea
£0.00
£101.50/ea £0.00
10 µgQM-0197709-02
10 µgQM-0197709-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0197709-03
50 µgQM-0197709-03
£437.58/ea
£0.00
£437.58/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

LHPP, Human (His-SUMO)

LHPP, Human (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.