Name: LIF, Human (HEK293)
Brand: QuantiMol
SKU: QM-0205985-01
Price: 62.26 GBP
Availability: InStock

Product Details

Description
LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.
Molecular Formula
3976 (Gene_ID) P15018-1 (S23-F202) (Accession)
Smiles
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Purity
97.7
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205985-01	2 µgQM-0205985-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

5 µgQM-0205985-02	5 µgQM-0205985-02 £104.88/ea	£0.00	Quantity	£104.88/ea	£0.00

10 µgQM-0205985-03	10 µgQM-0205985-03 £145.38/ea	£0.00	Quantity	£145.38/ea	£0.00

20 µgQM-0205985-04	20 µgQM-0205985-04 £246.83/ea	£0.00	Quantity	£246.83/ea	£0.00

50 µgQM-0205985-05	50 µgQM-0205985-05 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

100 µgQM-0205985-06	100 µgQM-0205985-06 £616.19/ea	£0.00	Quantity	£616.19/ea	£0.00

500 µgQM-0205985-07	500 µgQM-0205985-07 £1,633.14/ea	£0.00	Quantity	£1,633.14/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

LIF, Human (HEK293)

LIF, Human (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.