LIF, Rat (HEK293, His)

Name: LIF, Rat (HEK293, His)
Brand: QuantiMol
SKU: QM-0202887-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202887-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Lif Protein, a cytokine, plays a vital role in cell proliferation, differentiation, and immune response regulation. Dysregulation of Lif Protein has been linked to various diseases, including cancer and inflammatory disorders. Targeting Lif Protein may offer potential therapeutic interventions in these conditions by modulating cell growth, promoting immune regulation, and suppressing inflammation. LIF Protein, Rat (HEK293, His) is the recombinant rat-derived LIF protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
60584 (Gene_ID) P17777 (S23-F202) (Accession)
Smiles
SPLPITPVNATCAIRHPCHGNLMNQIKSQLAQLNGSANALFISYYTAQGEPFPNNVDKLCAPNMTDFPPFHANGTEKTKLVELYRMVTYLGASLTNITWDQKNLNPTAVSLQIKLNATTDVMRGLLSSVLCRLCNKYHVGHVDVPCVPDNSSKEAFQRKKLGCQLLGTYKQVISVLAQAF
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202887-01	2 µgQM-0202887-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0202887-02	10 µgQM-0202887-02 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

50 µgQM-0202887-03	50 µgQM-0202887-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0202887-04	100 µgQM-0202887-04 £520.20/ea	£0.00	Quantity	£520.20/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

LIF, Rat (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.