Skip to product information
1 of 1

LILRA2/CD85h/ILT1, Human (HEK293, His)

LILRA2/CD85h/ILT1, Human (HEK293, His)

Size

SKU:QM-0117453

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The LILRA2/CD85h/ILT1 protein is critical in the innate immune response and recognizes N-terminally truncated immunoglobulins from a variety of pathogenic bacteria and fungi. It interacts with cleaved IgM, IgG3 and IgG4, triggering neutrophil and monocyte activation. LILRA2/CD85h/ILT1 Protein, Human (HEK293, His) is the recombinant human-derived LILRA2/CD85h/ILT1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    11027 (Gene_ID) Q8N149-2 (G24-S420) (Accession)

  • Smiles

    GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSAS

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0117453
1 EachQM-0117453
£0.00/ea
£0.00
£0.00/ea £0.00

LILRA2/CD85h/ILT1, Human (HEK293, His)

LILRA2/CD85h/ILT1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.