LILRA2/CD85h/ILT1, Human (HEK293, His)
LILRA2/CD85h/ILT1, Human (HEK293, His)
SKU:QM-0117453
Request quote or documents

Product Details
-
Description
The LILRA2/CD85h/ILT1 protein is critical in the innate immune response and recognizes N-terminally truncated immunoglobulins from a variety of pathogenic bacteria and fungi. It interacts with cleaved IgM, IgG3 and IgG4, triggering neutrophil and monocyte activation. LILRA2/CD85h/ILT1 Protein, Human (HEK293, His) is the recombinant human-derived LILRA2/CD85h/ILT1 protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
11027 (Gene_ID) Q8N149-2 (G24-S420) (Accession)
-
Smiles
GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSAS
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
LILRA2/CD85h/ILT1, Human (HEK293, His)
LILRA2/CD85h/ILT1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.