LILRA5/CD85f, Human (Biotinylated, HEK293, His-Avi)

The LILRA5/CD85f protein may trigger innate immune responses independently of recognition of MHC class I antigens. This unique feature suggests a unique role in early defense against pathogens, acting through a pathway that is independent of MHC class I antigen recognition. LILRA5/CD85f Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRA5/CD85f protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

353514 (Gene_ID) A6NI73-1 (G42-R268) (Accession)

GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Room temperature in continental US; may vary elsewhere.