1 1

LILRB1/CD85j/ILT2, Rhesus Macaque (HEK293, His)

LILRB1/CD85j/ILT2, Rhesus Macaque (HEK293, His)

Size

QM-0197800-01

£58.12 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    LILRB1/CD85j/ILT2 Protein is an inhibitory receptor broadly expressed on leukocytes and recognizes HLA-class I and human cytomegalovirus UL18[1]. LILRB1/CD85j/ILT2 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    692340 (Gene_ID) F7H3G7 (S17-H456) (Accession)

  • Smiles

    SRTRVQAGTFPKPTLWAEPGSMISKGSPVTLRCQGSLPVQDYRLQREKKTASWVRRIQQELVKKGYFPIASITSEHAGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVTLQCDSQVAGGFVLCKEGEDEHPQCLNSQPHTRGSSRAVFSVGPVSPSRRWSYRCYGYDSRSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGDKLTLQCGSDAGYNRFALYKEGERDFLQRPGRQPQAGLSQANFLLDPVRRSHGGQYRCSGAHNLSSEWSAPSDPLDILIAGQIRGRPSLLVQPGPTVVSGENVTLLCQSSWQFHVFLLTQAGAADAHLHLRSMYKYPKYQAEFPMSPVTSAHAGTYRCYGSHSSDSYLLSIPSDPLELVVSGPSGGPSSPTTGPTSTCGPEDQPLTPTGSDPQSGLGRH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0197800-01
5 µgQM-0197800-01
£58.12/ea		 £0.00
£58.12/ea £0.00
10 µgQM-0197800-02
10 µgQM-0197800-02
£72.61/ea		 £0.00
£72.61/ea £0.00
50 µgQM-0197800-03
50 µgQM-0197800-03
£137.50/ea		 £0.00
£137.50/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

LILRB1/CD85j/ILT2, Rhesus Macaque (HEK293, His)

LILRB1/CD85j/ILT2, Rhesus Macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.