1 1

LILRB2/CD85d/ILT-4, Human (Biotinylated, HEK293, Avi-His)

LILRB2/CD85d/ILT-4, Human (Biotinylated, HEK293, Avi-His)

Size

QM-0178664-01

Price on request

Request quote or documents

View full details

Product Details

  • Description

    The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

  • Molecular Formula

    10288 (Gene_ID) Q8N423 (Q22-H458) (Accession)

  • Smiles

    QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
100 µgQM-0178664-01
100 µgQM-0178664-01
£0.00/ea		 £0.00
£0.00/ea £0.00
20 µgQM-0178664-02
20 µgQM-0178664-02
£0.00/ea		 £0.00
£0.00/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

LILRB2/CD85d/ILT-4, Human (Biotinylated, HEK293, Avi-His)

LILRB2/CD85d/ILT-4, Human (Biotinylated, HEK293, Avi-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.