Skip to product information
1 of 1

LMCD1, Human (His)

LMCD1, Human (His)

Size

SKU:QM-0082012

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The LMCD1 protein is a transcriptional cofactor that regulates GATA6 by blocking its DNA binding, thereby inhibiting transcriptional activation in lung and heart tissues. It inhibits GATA6-mediated transactivation of tissue-specific promoters, which is critical for developmental processes. LMCD1 Protein, Human (His) is the recombinant human-derived LMCD1 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

  • Molecular Formula

    29995 (Gene_ID) Q9NZU5-1 (M1-S365) (Accession)

  • Smiles

    MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0082012
1 EachQM-0082012
£0.00/ea
£0.00
£0.00/ea £0.00

LMCD1, Human (His)

LMCD1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.