LMCD1, Human (His)
LMCD1, Human (His)
SKU:QM-0082012
Request quote or documents

Product Details
-
Description
The LMCD1 protein is a transcriptional cofactor that regulates GATA6 by blocking its DNA binding, thereby inhibiting transcriptional activation in lung and heart tissues. It inhibits GATA6-mediated transactivation of tissue-specific promoters, which is critical for developmental processes. LMCD1 Protein, Human (His) is the recombinant human-derived LMCD1 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
-
Molecular Formula
29995 (Gene_ID) Q9NZU5-1 (M1-S365) (Accession)
-
Smiles
MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
LMCD1, Human (His)
LMCD1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.