Skip to product information
1 of 1

LOX-1/OLR1, Human (HEK293, His)

LOX-1/OLR1, Human (HEK293, His)

Size

SKU:QM-0205522-01

£59.16 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The OLR1 protein is a receptor on vascular endothelial cells that plays a key role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) . As a marker of atherosclerosis, oxLDL induces activation of vascular endothelial cells, leading to proinflammatory responses, oxidative conditions, and apoptosis. OLR1 Protein, Human (HEK293, His) is the recombinant human-derived OLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    4973 (Gene_ID) P78380-1 (S61-Q273) (Accession)

  • Smiles

    SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

  • Purity

    99

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205522-01
5 µgQM-0205522-01
£59.16/ea
£0.00
£59.16/ea £0.00
10 µgQM-0205522-02
10 µgQM-0205522-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0205522-03
50 µgQM-0205522-03
£238.32/ea
£0.00
£238.32/ea £0.00
100 µgQM-0205522-04
100 µgQM-0205522-04
£370.76/ea
£0.00
£370.76/ea £0.00
500 µgQM-0205522-05
500 µgQM-0205522-05
£1,156.87/ea
£0.00
£1,156.87/ea £0.00
1 mgQM-0205522-06
1 mgQM-0205522-06
£1,821.47/ea
£0.00
£1,821.47/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

LOX-1/OLR1, Human (HEK293, His)

LOX-1/OLR1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.