Skip to product information
1 of 1

LOX, Human (C-His)

LOX, Human (C-His)

Size

SKU:QM-0026303

Price on request
Quantity

Request quote or documents

View full details
  • Description

    LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (C-His) is the recombinant human-derived LOX protein, expressed by E. coli, with C-6*His labeled tag.

  • Molecular Formula

    4015 (Gene_ID) P28300 (P174-Y417) (Accession)

  • Smiles

    PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0026303
1 EachQM-0026303
£0.00/ea
£0.00
£0.00/ea £0.00

LOX, Human (C-His)

LOX, Human (C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.