LRG1, Mouse (HEK293, His)

Name: LRG1, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0177269-01
Price: 122.88 GBP
Availability: InStock

Size 5 µg 20 µg 50 µg 100 µg 500 µg

SKU:QM-0177269-01

£122.88 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
LRG1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived LRG1 protein, expressed by HEK293, with C-8*His labeled tag.
Molecular Formula
76905 (Gene_ID) Q91XL1 (L33-L342) (Accession)
Smiles
LKECLILQSAEGSTVSCHGPTEFPSSLPADTVHLSVEFSNLTQLPAAALQGCPGLRELHLSSNRLQALSPELLAPVPRLRALDLTRNALRSLPPGLFSTSANLSTLVLRENQLREVSAQWLQGLDALGHLDLAENQLSSLPSGLLASLGALHTLDLGYNLLESLPEGLLRGPRRLQRLHLEGNRLQRLEDSLLAPQPFLRVLFLNDNQLVGVATGSFQGLQHLDMLDLSNNSLSSTPPGLWAFLGRPTRDMQDGFDISHNPWICDKNLADLCRWLVANRNKMFSQNDTRCAGPEAMKGQRLLDVAELGSL
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0177269-01	5 µgQM-0177269-01 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

20 µgQM-0177269-02	20 µgQM-0177269-02 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

50 µgQM-0177269-03	50 µgQM-0177269-03 £567.59/ea	£0.00	Quantity	£567.59/ea	£0.00

100 µgQM-0177269-04	100 µgQM-0177269-04 £879.85/ea	£0.00	Quantity	£879.85/ea	£0.00

500 µgQM-0177269-05	500 µgQM-0177269-05 £1,710.90/ea	£0.00	Quantity	£1,710.90/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

LRG1, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.