LSAMP, Human (HEK293, His)
LSAMP, Human (HEK293, His)
SKU:QM-0188755-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
LSAMP proteins are key mediators that orchestrate selective neuronal growth and precise axonal targeting, playing a critical role in guiding axonal development and promoting mature circuit remodeling within the limbic system. Its importance extends to ensuring the normal growth of hippocampal mossy fiber projections, which contribute to the formation of complex neural pathway structures. LSAMP Protein, Human (HEK293, His) is the recombinant human-derived LSAMP protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
4045 (Gene_ID) Q13449 (V29-N315) (Accession)
-
Smiles
VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN
-
Purity
95
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0055073-01 (10Z,13Z) -Nonadeca-10,13-dienoic acid [CAS 29204-20-4]
- QM-0055025-01 20-O-Acetylcamptothecin [CAS 7688-64-4]
- QM-0055022 3'-Azidomethyi-dGTP [CAS 1048022-06-5]
- QM-0054666 DGTPαS [CAS 82337-56-2]
- QM-0054664 DATPαS [CAS 64145-28-4]
- QM-0054663 3’-O-Acetyl-dATP (sodium)
- QM-0054662 3'-O-Acetyl-dATP [CAS 28120-63-0]
- QM-0054521-01 Methoxycarbonyl Cefadroxil-d6 [CAS 1246819-89-5]
Other industry favorites
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0053863 L- (+) -Ampicillin-d5
- QM-0053811 L-Glutathione reduced-d5 (ammonium)
- QM-0053172 Methacryloyl-CoA [CAS 6008-91-9]
- QM-0053171 3-Hydroxy-2-methylbutyryl-CoA [CAS 6701-38-8]
- QM-0054252 Acetyl-L-carnitine (hydrochloride) -13C3
- QM-0054203-01 MDMB-FUBINACA metabolite M1 [CAS 2693397-47-4]
- QM-0053343-01 2-Bromoamphetamine (hydrochloride) [CAS 861006-36-2]
- QM-0053309-01 3-Oxohexadecanoyl-CoA [CAS 34619-89-1]
LSAMP, Human (HEK293, His)
LSAMP, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.