Skip to product information
1 of 1

Lymphocyte antigen 6C1/LY6C1, Mouse (P.pastoris, His) [CAS 9007-83-4]

Lymphocyte antigen 6C1/LY6C1, Mouse (P.pastoris, His) [CAS 9007-83-4]

Size

SKU:QM-0090061

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Lymphocyte antigen 6C1 enables acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity.Lymphocyte antigen 6C1 is involved in acetylcholine receptor signaling pathway.Lymphocyte antigen 6C1/LY6C1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Lymphocyte antigen 6C1/LY6C1 protein, expressed by P.pastoris , with N-6*His labeled tag.

  • CAS Number

    [9007-83-4]

  • Molecular Formula

    17067 (Gene_ID) P0CW02 (L27-G109) (Accession)

  • Smiles

    LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0090061
1 EachQM-0090061
£0.00/ea
£0.00
£0.00/ea £0.00

Lymphocyte antigen 6C1/LY6C1, Mouse (P.pastoris, His) [CAS 9007-83-4]

Lymphocyte antigen 6C1/LY6C1, Mouse (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.