Skip to product information
1 of 1

LYPD3/C4.4A, Human (HEK293, His)

LYPD3/C4.4A, Human (HEK293, His)

Size

SKU:QM-0103216

Price on request
Quantity

Request quote or documents

View full details
  • Description

    LYPD3/C4.4A protein facilitates cell migration and potentially influences urothelial cell-matrix interactions.It plays a role in tumor progression, binding to laminin-1 and laminin-5.Interactions with LGALS3, AGR2, and AGR3 emphasize its functional associations and impact in diverse biological processes.LYPD3/C4.4A Protein, Human (HEK293, His) is the recombinant human-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    27076 (Gene_ID) O95274 (L31-H286) (Accession)

  • Smiles

    LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEH

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0103216
1 EachQM-0103216
£0.00/ea
£0.00
£0.00/ea £0.00

LYPD3/C4.4A, Human (HEK293, His)

LYPD3/C4.4A, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.