LYPD3/C4.4A, Human (HEK293, His)
LYPD3/C4.4A, Human (HEK293, His)
SKU:QM-0103216
Request quote or documents

Product Details
-
Description
LYPD3/C4.4A protein facilitates cell migration and potentially influences urothelial cell-matrix interactions.It plays a role in tumor progression, binding to laminin-1 and laminin-5.Interactions with LGALS3, AGR2, and AGR3 emphasize its functional associations and impact in diverse biological processes.LYPD3/C4.4A Protein, Human (HEK293, His) is the recombinant human-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-6*His labeled tag.
-
Molecular Formula
27076 (Gene_ID) O95274 (L31-H286) (Accession)
-
Smiles
LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEH
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
LYPD3/C4.4A, Human (HEK293, His)
LYPD3/C4.4A, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.