Skip to product information
1 of 1

LYVE-1, Human (HEK293, His)

LYVE-1, Human (HEK293, His)

Size

SKU:QM-0187173-01

£193.37 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The LYVE-1 protein is a ligand-specific transporter that regulates molecular transport between the trans-Golgi network (TGN) and the plasma membrane. It plays a key role in autocrine cell growth regulation, mediating the uptake and catabolism of growth regulators through cell surface retention sequences. LYVE-1 Protein, Human (HEK293, His) is the recombinant human-derived LYVE-1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    10894 (Gene_ID) AAH26231.1 (L20-T238) (Accession)

  • Smiles

    LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPT

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0187173-01
10 µgQM-0187173-01
£193.37/ea
£0.00
£193.37/ea £0.00
50 µgQM-0187173-02
50 µgQM-0187173-02
£481.32/ea
£0.00
£481.32/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

LYVE-1, Human (HEK293, His)

LYVE-1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.