Skip to product information
1 of 1

M-CSF, Human (223a.a, HEK293, His)

M-CSF, Human (223a.a, HEK293, His)

Size

SKU:QM-0075372-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (223a.a, HEK293, His) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    1435 (Gene_ID) P09603-1 (E33-R255) (Accession)

  • Smiles

    EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0075372-01
2 µgQM-0075372-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0075372-02
10 µgQM-0075372-02
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0075372-03
50 µgQM-0075372-03
£337.95/ea
£0.00
£337.95/ea £0.00
100 µgQM-0075372-04
100 µgQM-0075372-04
£539.64/ea
£0.00
£539.64/ea £0.00
500 µgQM-0075372-05
500 µgQM-0075372-05
£1,488.56/ea
£0.00
£1,488.56/ea £0.00
1 mgQM-0075372-06
1 mgQM-0075372-06
£2,595.43/ea
£0.00
£2,595.43/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

M-CSF, Human (223a.a, HEK293, His)

M-CSF, Human (223a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.