Skip to product information
1 of 1

M-CSF, Human (CHO)

M-CSF, Human (CHO)

Size

SKU:QM-0203652-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human (CHO) is a recombinant human M-CSF protein expressed in CHO cells with tag-free.

  • Molecular Formula

    1435 (Gene_ID) P09603-3 (E33-S190) (Accession)

  • Smiles

    EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203652-01
2 µgQM-0203652-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0203652-02
10 µgQM-0203652-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0203652-03
50 µgQM-0203652-03
£404.78/ea
£0.00
£404.78/ea £0.00
100 µgQM-0203652-04
100 µgQM-0203652-04
£604.04/ea
£0.00
£604.04/ea £0.00
250 µgQM-0203652-05
250 µgQM-0203652-05
£1,046.30/ea
£0.00
£1,046.30/ea £0.00
500 µgQM-0203652-06
500 µgQM-0203652-06
£1,544.45/ea
£0.00
£1,544.45/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

M-CSF, Human (CHO)

M-CSF, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.