M-CSF, Rat (CHO)

Name: M-CSF, Rat (CHO)
Brand: QuantiMol
SKU: QM-0195576-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0195576-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
M-CSF Protein, Rat (CHO) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.
Molecular Formula
78965 (Gene_ID) Q8JZQ0-1 (E33-P186) (Accession)
Smiles
EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKP
Purity
95.2
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0195576-01	2 µgQM-0195576-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0195576-02	10 µgQM-0195576-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0195576-03	50 µgQM-0195576-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0195576-04	100 µgQM-0195576-04 £664.79/ea	£0.00	Quantity	£664.79/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

M-CSF, Rat (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.