M-CSF, Rat (HEK293)

Name: M-CSF, Rat (HEK293)
Brand: QuantiMol
SKU: QM-0189372-01
Price: 238.32 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0189372-01

£238.32 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Rat (HEK293) is the recombinant rat-derived M-CSF protein, expressed by HEK293 , with tag free.
Molecular Formula
78965 (Gene_ID) Q8JZQ0-1 (E33-R254) (Accession)
Smiles
EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0189372-01	10 µgQM-0189372-01 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

50 µgQM-0189372-02	50 µgQM-0189372-02 £614.98/ea	£0.00	Quantity	£614.98/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

M-CSF, Rat (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.