MAGP-2/MFAP5, Human (HEK293, hFc)
MAGP-2/MFAP5, Human (HEK293, hFc)
SKU:QM-0106377
Request quote or documents

Product Details
-
Description
MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (HEK293, hFc) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by HEK293 , with C-hFc labeled tag.
-
Molecular Formula
8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)
-
Smiles
IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
MAGP-2/MFAP5, Human (HEK293, hFc)
MAGP-2/MFAP5, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.