Skip to product information
1 of 1

MAGP-2/MFAP5, Human (HEK293, hFc)

MAGP-2/MFAP5, Human (HEK293, hFc)

Size

SKU:QM-0106377

Price on request
Quantity

Request quote or documents

View full details
  • Description

    MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (HEK293, hFc) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    8076 (Gene_ID) Q13361-1 (I22-L173) (Accession)

  • Smiles

    IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0106377
1 EachQM-0106377
£0.00/ea
£0.00
£0.00/ea £0.00

MAGP-2/MFAP5, Human (HEK293, hFc)

MAGP-2/MFAP5, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.